PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN37942.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 258aa    MW: 29930.6 Da    PI: 6.5141
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN37942.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.83.8e-161663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd+ll ++v ++G g+W+++a++ g++R +k+c++rw +yl
       KHN37942.1 16 KGPWTGEEDKLLSEYVCLHGEGRWSSVAQCTGLKRNGKSCRLRWVNYL 63
                     79******************************9*************97 PP

2Myb_DNA-binding43.85.8e-1473113547
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      T+ E  +++++++ +G++ W+tIa++++ gRt++++k++w+++
       KHN37942.1  73 TPIEVGIIIELHAIFGNK-WSTIAKYLP-GRTDNDIKNYWRTH 113
                      66666789**********.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.3551167IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.1E-211166IPR009057Homeodomain-like
SuperFamilySSF466896.36E-2914110IPR009057Homeodomain-like
SMARTSM007173.2E-131565IPR001005SANT/Myb domain
PfamPF002499.6E-151663IPR001005SANT/Myb domain
CDDcd001671.34E-91863No hitNo description
Gene3DG3DSA:1.10.10.606.2E-2267116IPR009057Homeodomain-like
PROSITE profilePS5129416.93168118IPR017930Myb domain
SMARTSM007176.6E-1268116IPR001005SANT/Myb domain
PfamPF002495.0E-1270113IPR001005SANT/Myb domain
CDDcd001675.37E-973114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MEAVMGSLAT EKEWRKGPWT GEEDKLLSEY VCLHGEGRWS SVAQCTGLKR NGKSCRLRWV  60
NYLRPGLKRG QLTPIEVGII IELHAIFGNK WSTIAKYLPG RTDNDIKNYW RTHFEKSGKS  120
KHKKLEMQKA KVLKQLKQKQ QPQEYDVKSI KSHEETKNET KSYETENNKQ KEVDFMCPTM  180
EHQYIVPSMH EGFSSTWPDT VLGDDGSWFS LWDFDDEPQC SADYVNQFSE SVVPNQATFG  240
VGEDSMQNHD KIFYFDDI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-231611627126MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00388DAPTransfer from AT3G30210Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003551775.10.0PREDICTED: transcription factor WER-like
TrEMBLA0A0B2S1E90.0A0A0B2S1E9_GLYSO; Transcription factor MYB59
STRINGGLYMA18G50891.11e-162(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF118234108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30210.11e-63myb domain protein 121
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]